Conserved Protein Domain Family
PHA02902

?
PHA02902: PHA02902 
putative IMV membrane protein; Provisional
Statistics
?
PSSM-Id: 165225
View PSSM: PHA02902
Aligned: 2 rows
Threshold Bit Score: 110.033
Threshold Setting Gi: 40556189
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634848   2 GIIDTFVITAVTVIIFCLLIYAAYKRYKCIPsPDDRDKVLKSTLNDDTLFNQTLTPDQVKALHRLVTSSI 71 
40556189  1 MAVDTFVILAVIVVIVCLLIYAAYRRYKGIP-PRNTEERFGDYLEKDPLFKDSLTPDQIRALHRLVSLSV 69 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap