Conserved Protein Domain Family
PHA02898

?
PHA02898: PHA02898 
virion envelope protein; Provisional
Statistics
?
PSSM-Id: 165223
View PSSM: PHA02898
Aligned: 2 rows
Threshold Bit Score: 130.014
Threshold Setting Gi: 9634849
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556190  1 MDPIGFFKNRPSYVVALGIVLLIVACIIAYIELYKSEKPGDTTLRVISIISFVVAMILILGIVFFKGYSMFCGGSTTEEv 80 
9634849   1 MDPLGFFRNRPSYVVVFGIILLIVACICAYIELSKSGKPADSALRSISIISFILAILLLLGIILFSGYNRYCTGNVVDE- 79 
40556190 81 TRYANSNDIEVQ 92 
9634849  80 SRYATSPGTEIQ 91 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap