Conserved Protein Domain Family
PHA02896

?
PHA02896: PHA02896 
A-type inclusion like protein; Provisional
Statistics
?
PSSM-Id: 165222
View PSSM: PHA02896
Aligned: 2 rows
Threshold Bit Score: 1074.28
Threshold Setting Gi: 40556202
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634860    1 MGWDKCGIEKCIRKFETLIVRTWDHDLNERSFLTRRDRKVVRNIFRCFIHYSCDNDRIHGVQAQLLYPKNLENYFLGEFI 80 
40556202   1 MGRDGCGIDKCIRKFESLVIRTWDQDLNERSFLNRKDRKIIRNIFRNFIHYSCDTDLIHGIQSQVLYPKSLDNHFLCEFM 80 
9634860   81 KYNNNGIKKLYNKIDMSNDRMPDISTKGRYVLYFVMYLLYMGNNDTKFSYSDSGRTVSKKVSSIVTDYLRLVSSVHYRFK 160
40556202  81 RYNNHGIKKLYNKIDMSNDRMPDISTKGRYIVYFVVFLLYMGNNDTKFNYTDSSYNVSKKISEIVTDYLRLISSVHSRFK 160
9634860  161 CKCMFIGLPVYYIHLMSPDDIITAMESVGRKPRTGPEEYERNTTIHIKEMCAYQDFLNFIMASKKAKTKGLKISLCGIPF 240
40556202 161 CRCMFIGLPTYYVYLMSADDIIMAMESVGDKPRNGPEEYERTSTIHIREMCAYQDFLNFIVASKKAKNKGLCVKLCGIPF 240
9634860  241 ETDYSISEQVMDGLCYCFTDEVTIKKNHYDFVQLYTKCHIGDSYEYIRLTDEFPTTKMSFSPNCIHDCSAIRIFKDKDND 320
40556202 241 ETDYSMSELIMDGLCYCFTDEVTIKKGYYEFVQLYTKCHIGDTYEYLRLTDEYPSTKMSFSPNCDYDCSSIRIFKDKDND 320
9634860  321 FYQNRHMLFFPDDCRRWKWYLDDDKYPSYDYSNDRERRPKDYQEYYIDNFECDRRKNCPstngtlnRNEDEFPREEDYDD 400
40556202 321 FYQNRHTLFFPDDCRRWKWYLDEDKHPSYDYSNDRERRPRDYKEYYIDNTECDKMKNCP-------RDKDKDKINETNPE 393
9634860  401 YnnNNEDDLIKDEAPIL-RRHNSMEDVYNKRHHR--RNKYDIYDD----YNYKHKKyDDRGNSDDEHIVPKRANNLESAK 473
40556202 394 Y--DDEDNLIKDEAPMLnRRHGQRDKKYDRRDNRykNRRYDRYEDesprYKYKDDD-NDNDDNNDDRIIPRKINNLEDAR 470
9634860  474 DFEDEMMDAIHNDDYTPKSLRNRRNGYLLKDEDrYYYDRGHRNLGVEKDVYRPHPDKDREypREKDKSDEDRLNDVDRAM 553
40556202 471 EFEDEMMEAIADDDYTPNSIRRRRNRYLPRDEE-YYYDRGYRYLMAERNPEKRYPGKKER--EDRQKSDDERMNDADKAV 547
9634860  554 RKLEADSFGDSYRKIKSKMERLEEDYDHLRKHAIELPKKLDNQS---DRDYDRSWF 606
40556202 548 RRLESNGFKDRYRRIKEKMDNLEDNYEDLRKHAIELPRKLDSQSgngDYREPKSWF 603
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap