Conserved Protein Domain Family
PHA02894

?
PHA02894: PHA02894 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165221
View PSSM: PHA02894
Aligned: 2 rows
Threshold Bit Score: 156.246
Threshold Setting Gi: 40556192
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634850   1 MYIENNSLVlIIPETNSITPQLFTIHDNKPICVCSRYSLIPSKKENVQISYIDNIHMYFRSFKNLYLVNPRNHDIIKVFN 80 
40556192  1 MYIENNSLV-IIPSRINLIPSLFVIGNKKSVCVCNRYSLIPSNNENVQLSRIDDMHLYFKKHKNIYIVNPYRHEIIRIFH 79 
9634850  81 FLKNYKWGGNFYLLFNV 97 
40556192 80 FIKKNKWEGGFYLLFNV 96 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap