Conserved Protein Domain Family
PHA02893

?
PHA02893: PHA02893 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165220
View PSSM: PHA02893
Aligned: 2 rows
Threshold Bit Score: 126.804
Threshold Setting Gi: 40556196
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634854   1 MADSTAGAKKRKKRSTSATstrKEPPTVIPEDECTTCSICQSKLVMFSGVSKYKLSDYLNTGKVFTNSNIRCKACGSSLC 80 
40556196  5 DAASTAGAKKRKRKTRSSV---RKEETAIPEDACTTCQVCQSKLVMFSGVNKYNLKEYLSIGKAFSSSNLKCIACGSSLC 81 
9634854  81 HLRDLSKS 88 
40556196 82 NLSDLSKS 89 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap