Conserved Protein Domain Family
PHA02892

?
PHA02892: PHA02892 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165219
View PSSM: PHA02892
Aligned: 2 rows
Threshold Bit Score: 83.9713
Threshold Setting Gi: 9634864
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556206  1 MDDVnDYIDDINEDSINHMLSTLVNVKDPEFSASISLMQEIIKIINSKIIELEKKYKKNKPIINSSNNVSSRISY 75 
9634864   1 MDDI-DYIDDINEDSINHMLSTLANVRDPEFSATISLMQEVLKIINSRIIEIDKKYKKNNRNINSMNNASSRVSY 74 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap