Conserved Protein Domain Family
PHA02891

?
PHA02891: PHA02891 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165218
View PSSM: PHA02891
Aligned: 2 rows
Threshold Bit Score: 184.362
Threshold Setting Gi: 9634866
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556208   1 MEAINIMRDIKRGRDITPSMIKKFIQSLDIEAAVNKPLPIVLGSKMITDKRIIYSKDHIYGMIQLFYGYIPKTIKRKDFF 80 
9634866    1 MDILTIMKRIKSGKDITPSMVTRFVELVGNKELFYDPLPIKLSSSTLTGRNINYSEEHVKSMIVIIYGYLPSIIKKKIFV 80 
40556208  81 NIMSRRIISPPDDFMNSIFGNEVQLDINIFAETFLKELNR 120
9634866   81 NKISKLLSIPPDDALKRIFGDTSEIGVNTFIKKFLAELTS 120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap