Conserved Protein Domain Family
PHA02890

?
PHA02890: PHA02890 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165217
View PSSM: PHA02890
Aligned: 2 rows
Threshold Bit Score: 456.325
Threshold Setting Gi: 40556211
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634871    7 MYKTINTTGISCVLKSLIPDSYNEEYNIDDLDLLKIKEFIEISMQRCFSIKSVTDSTVLYIE-NRTNRYSISTSHDKNEp 85 
40556211   1 MYKTVNTSQITCYLQDLLPDKFDEEEDVPEGDMERLKGFIELCINKSYSVTNISDITVLCIEpANTNKYYLTTNISNYE- 79 
9634871   86 YEENGIIMNNIECYFVACLEGSCTVNVNLGDRQISDNISESSGFLMDVNTDHVIDTKYVGLFITKIKVDAHVFYGQNVIM 165
40556211  80 HHENDIAVKKIECFFVTCIENSCKINVSIGDREISDHIHENQGVIMDVGLEHAIYSDNVTLLVVKFEVDASIFYSRNVII 159
9634871  166 FPEKNLFSQTNGPNFILYDITVQDRNVLLLITSKYIYNLCDDKYYDIFELKYLVDNCKLPMPLIPLSKYDFTFTDLSVIK 245
40556211 160 FPEENLLSQFYGPNFILYDIVNQDFNLRLLVTKDNIYNLTTSDVYNIMDLRYLFYNYNLPMPTISLSQYEFTVCDMNAIR 239
9634871  246 SENVKTVLSKVHTSMKSYYNNDTslpVAVKVIYGTVTI 283
40556211 240 SVDIESILRKVSACTETTHYENT---LHIKVLYGTVIL 274
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap