Conserved Protein Domain Family
PHA02889

?
PHA02889: PHA02889 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165216
View PSSM: PHA02889
Aligned: 2 rows
Threshold Bit Score: 291.55
Threshold Setting Gi: 9634875
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556214  10 VPTSLIILVICTYINVSFSCKRSILDNNGKVSINICPSTSQECISWMYIERMFLKQHDFVTLGMFMYPSTYHNTKPDELM 89 
9634875    1 MNRVIRILVILSNVVHVYPCKRSVSIEQSEANIILCPSTSIKCVKWMYVEKKEPKSQIYKTLGIMVFPDSYHIKEPNYLS 80 
40556214  90 NFTLSKIYLTRWTKGNLYQISIGVKKTCNKkgqdslQEIETIHIDDSLLVKEQDFvknlvsetYTSQEYDNITSVIIEHt 169
9634875   81 NLTLDKITLKRWSTGDVYHVSIGIKKKCMG------SVIESIFVDDSYITRRDNY--------NSTELYNNTTNIVLVH- 145
40556214 170 nnttknFFHYYKVYNYIVIPICTLLILIIVTYITCNNKtcFFKKYIDKIDDIEDFILIKLHQEKEPLFHDIEGIDVDSED 249
9634875  146 ------FLNNYQLYTLVLSSICVVIIIIIVCYISYKHK--YINKKIKTISNSEKFILINVHPDREPLITHIDESEYESDD 217
40556214 250 E 250
9634875  218 N 218
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap