Conserved Protein Domain Family
PHA02888

?
PHA02888: PHA02888 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165215
View PSSM: PHA02888
Aligned: 2 rows
Threshold Bit Score: 189.45
Threshold Setting Gi: 40556216
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634877    1 MISLPSSCQNIINTVINGKCFFGRCSNKRLKMTVPMTSSELAYIQEWMLEKHDLFIEFPIDLITVEHIMMHLAVDVTTIK 80 
40556216   1 MISLPSSCQHVINRVINGECFFGKCENKKYAIKKAMTPQELEYIQKWLLEKHDLFIEFPIELSTMEHILYHLSSDVSTVK 80 
9634877   81 RKKSDITAYRTRLKDV 96 
40556216  81 RKKSIVNIRRYHTMKY 96 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap