Conserved Protein Domain Family
PHA02887

?
PHA02887: PHA02887 
EGF-like protein; Provisional
Statistics
?
PSSM-Id: 165214
View PSSM: PHA02887
Aligned: 2 rows
Threshold Bit Score: 187.442
Threshold Setting Gi: 9634881
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556223   1 MDTLIspIKVKNEYKLISNLLSNKTTLAVSMIIVLLVFNIAFYSYRINELLIIKRNFESHISKIVYSENTNSYTFKRTNS 80 
9634881    1 MKEPL--IEVKREYNLIKTLTGKKFVVSTSIVVVLLIINMIFYGIRIHELAVIRRNSETHISSFNYKGQAQAQNKRVKNT 78 
40556223  81 MFFKKCKNDYNDYCINGICRYIVDLSEVVCLCNRGYTGIRCEEYTI 126
9634881   79 RLFEKCKSKFNNFCIYGECMNIINLDKKFCICNKGYTGNRCDIVSI 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap