Conserved Protein Domain Family
PHA02885

?
PHA02885: PHA02885 
putative interleukin binding protein; Provisional
Statistics
?
PSSM-Id: 165213
View PSSM: PHA02885
Aligned: 2 rows
Threshold Bit Score: 199.106
Threshold Setting Gi: 9634884
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556227   5 KVFLVIQLISLLIIHVYMMDGNECpkdsnNNNILTVYKDNSSSNSNFSRLVCSGCLNSEDGYIYWLVPNNTspgeyiFPQ 84 
9634884    1 MLYIYIISTSILLVKGYVIENNNC-----GCGNITASKDVTTSNSTFDRLLCTVYMSSEDGYIYWIGPNST------FIE 69 
40556227  85 SVSGMVEGQDVTQALGDDIYKHTRELNISSADYTGKNFSCVSITESGTTFYQIIV 139
9634884   70 NLEGANEGSDNTFEVGNECYKHTRELNITSRDYVGKNFTCTSMTEYGTTFFNVIL 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap