Conserved Protein Domain Family
PHA02884

?
PHA02884: PHA02884 
ankyrin repeat protein; Provisional
Statistics
?
PSSM-Id: 165212
View PSSM: PHA02884
Aligned: 2 rows
Threshold Bit Score: 365.845
Threshold Setting Gi: 40556231
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634886    5 SIINNLIDIITLYIRIFYVIYYIaIKSKNQICIANILYTSIKFYYTDIIDAVLKRGIDPNIPFPlSENSYVNPLIYAIEC 84 
40556231   1 MLYINLVNYVVLLCRIIYISFYL-IRKKNKIDKTSVLYSSIKFHYYDVTNLILYLGANPEAQHP-SLVVKTTPLIYSVDY 78 
9634886   85 DNHDAILSLIRYGADVNTYSNYLVITPLYISVLHGCPKCVEILLYYGANINIVTYKMvTPIELASRICYNNLAFMVCDRT 164
40556231  79 NNDIAAKLLLSYGANVNRYAEEAKITPLYLSVLYSNLKCLNILLSYYPDINYQVNDM-TVIELSLMICNNFMSTVIKGNE 157
9634886  165 ITNI---PKKITYNFEIMKILVSHFIlqasndrLNNRHNKYFSEGYNKNKMLVSTSIILTYFKKQCIEDIDIMKNIKLGD 241
40556231 158 LSSFykhRNRYLINVDILKSLVSHFI-------LYEKHYVNKNAGYYKNKHLIIQSVILKQFRDLCNDDIMMMKSITVKN 230
9634886  242 D-----SFLDILVERNTMKLSTYISNQDILDIPKTVKVYNTRINMLLDeaiiynNINIIL 296
40556231 231 YsndmlSFFDILVNNDLISLLNNLDNIPITDLSKKLKVYNNKVKLFTE------SVTEMV 284
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap