Conserved Protein Domain Family
PHA02882

?
PHA02882: PHA02882 
putative serine/threonine kinase; Provisional
Statistics
?
PSSM-Id: 165211
View PSSM: PHA02882
Aligned: 2 rows
Threshold Bit Score: 549.939
Threshold Setting Gi: 40556237
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556237   8 SNNTVLQDITGKEWVIEKLLGFGGFGKVYEVSSRSDhciNNSLVAKIENLENETIVMETLVYNSMYEIDKINNWMRIHNI 87 
9634896    1 MEGIPLIDIYGKQWKIDKLIGCGGFGCVYSTQCASN---TRQAVIKVESLNNTTMVSEVLVYNNIYDKNRIALWKNYKNI 77 
40556237  88 DHLGIPKYYGCGYFKYCRVYYRFILLEKLYLSTNKIFSRILcYNKKLIKSITVDVLTTLEYIHSYGISHGDIRPENIMVD 167
9634896   78 DHLGIPMYYGCGSFKRNTMYYRFILLERLVENTKELLKRVK-KPKPLIKNIMKDMLYTLEYIHEHGISHGDIKPENIMVD 156
40556237 168 TNNRGYIIDYGIASHFIIHGKHIEYSKNQKDLRRGTVYYAGLDSHNGAKVTRRGDLESLGYCMLKWAKRKLPWKGL-HSS 246
9634896  157 GRYRSYLIDYGIVSYFIVNGKHVKYYKESKNWHRGTLYYASLDAHNGTCVTRRGDLESLGYCMLKWAGIPLPWKVFgNNG 236
40556237 247 SLIHAAKCDFIKRLHEGKIKYSNSTRFIYLFIETVTKLSYEETPDYQALIKIFD 300
9634896  237 NMVHVAKCDFIKRVHKNKVNIKSANKGIYDYIKCVTKLSYEEKPDYDLLRQLVN 290
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap