Conserved Protein Domain Family
PHA02876

?
PHA02876: PHA02876 
ankyrin repeat protein; Provisional
Statistics
?
PSSM-Id: 165207
View PSSM: PHA02876
Aligned: 2 rows
Threshold Bit Score: 1246.88
Threshold Setting Gi: 9634914
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40555947  12 MCPDDLYRIMCYGNCLDIVSAIDNYD-----ASQCENKSIPYTAIHQALQLRRLDVVEKIIQQNTESIYITDYKCHSTLH 86 
9634914    1 MWPDDLYRIMCRGNYIEILSAITNYNlhkhgANQCENESIPFTAIHQALQLRQIDIVKELIQQNPKLIYVTDHRRNSTLH 80 
40555947  87 TICIIPNVMDIVISLTLDCDIILDIKYVSIILNKYKLDEVCIHILKEAISGNDIHYDKINESIEYMKSIKERIQQDELRI 166
9634914   81 TICITPNVMDIVISLTVDCDIILDIKYASIILNKHKLGEACIHVLKEGISGNEISYNKINKSIEYMKLIKERIQQDELLI 160
40555947 167 AEMLLEGGADVNAKDIYSITPIHYAAKYGNARMVNLLLSYGADVNIIALDGLTVLECAVNSNNIDTIKAIIDNRSNINKN 246
9634914  161 AEMLLKKGIDVNAKDVYCRTPIHYAAERGNTKMVNLLLSYGADVNIITLDDLSVLEYAVDSKNIDTIKAIIDNRSNINKN 240
40555947 247 DLSLLNAISNEDLETSLLLYDAGFSVNSIDDCKNTPLHHASQTPSLSRLVPKLLERGADVNAKNIKGETPLYLMAKNGYD 326
9634914  241 DLSLLKAIRNTDLETSLLLYDSGFSVNSIDVYKNTPLHYAVQAPSLSRLVPKLLERGIDVNAKNIKGETPLYLMAKNGYD 320
40555947 327 TENIRTLISLGADVNATDRMYNTPLHQASTLDRNKDIVITLLELGANVNARDYYEKTPIHYAAVRNSVVIINTLLDYGAE 406
9634914  321 TENIRTLIMRGADVNAADSLYITPLHQASTLDRYKDTVITLLELGANVNARDYCDKTPIHYAAVRNNVVIINTLLDYGAD 400
40555947 407 IEALSQKIGTALHFALCGTNPYTSVKTLIDRGANVNSKNKDLSTPLHYACKNNCKLDVIEMLLDNGADVNAVNIQNQYPL 486
9634914  401 IEALSQKIGTVLHFALYGTNPYMSVKTLIDRGANVNSKNKYLSTPLHYACKKNCKPEVIKMLLDNGADVNAINIRNQYPL 480
40555947 487 LIALGYHSIVNILLHYGAELRDSRVLSKSLNDNMFSFSYIIAHICIQDFTSHDIRNGVNSLkrvptrftslresfKEIIQ 566
9634914  481 LIALEYHGIVNILLHYGAELRDSRVLHKSLNSNMFSFRYIIAHICIQDFIRHDIRSEVNPL--------------REIIQ 546
40555947 567 SDDTFRRIWSRCNEELKDISKIRINMFYSLDIFITSKNMNLLHRLVNNPIMKEINTWHFCNYGDRLRTSVSLATDRHEIL 646
9634914  547 SDDTFKSIWLSCKEELKDISKIRINMFYSLDIFVISKNMNLLHHLVNNPIIKEINTYYFYNYGDRLKTSISLASNRHKIL 626
40555947 647 EKSRSKLDEILYTSDWYKLPPDIKLSILEFIDNNELSKIYNY 688
9634914  627 EKSRSKLDEILDSSGWSKLPPDIKLSILEFIGNTELRKICNR 668
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap