Conserved Protein Domain Family
PHA02875

?
PHA02875: PHA02875 
ankyrin repeat protein; Provisional
Statistics
?
PSSM-Id: 165206
View PSSM: PHA02875
Aligned: 2 rows
Threshold Bit Score: 690.962
Threshold Setting Gi: 40556089
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634910    1 MDRVELCNAILFGELDVARRLLDSYINPNFTI-NGYSPIKMAVRLRDVEMIKLLMSYNTYPDYNyPDIESELHEAVEEGD 79 
40556089   2 NHQVAMCDAITTNNMNILSYMLNIGYNPNFELyDGISPLTLAMKFRNSVAIKLLMKHGAIPNVK-PGVRSPLHDAVVRGK 80 
9634910   80 VVKVEELLDSGKFINDVIYKKGNTPLHLATISKNLDMMRLLIARGADTDVPNTDRFTPLHLAVMSKDIKGIELLLDHRAC 159
40556089  81 VKAVEMLLMLNTYADDVFYKDGMTPLYLATKLQKVEIMKTLLKYKADPDISSTDKTSTLHLAVMMGDVNMTKLLIKHKAT 160
9634910  160 TNIEDCYGCTPLIIAMSKGDTEVCRMLLDSGANIDYFSKRPCVTAMCyAIQNNKIDMVSMFLKRGADSNIVFTVMNEEHT 239
40556089 161 LDLEDGCGYTPLLYAVAYKNIAICKVLLDSGANPNYVGRNGDVALLC-AVENNRPDIVRLLISRGADCNIMTMIEGEYCT 239
9634910  240 TLEMICNMDTNPESESVDMLIADIALRQYTNTiSSDKGFSRNMTVINSKSRLKDVFEKCKIELRRINSESIRTYNILDLC 319
40556089 240 ILDVIKNYCVNLKTEAIGALIAEIVISIHKKT-RRGEGFKNNTSTIEDTEEFLEVKTKCIQELTYMKSQKIGKKSLYEMF 318
9634910  320 L--KPSKNLDENILARHSRKILGLYDNAIFYKYLLKELADTASQRAEAIESAMRVIDEKItgDETKWNWLPHEIKYNILE 397
40556089 319 IleNNTHQQNENVLARNVKKILTVNNEIHIYRYLLREAVKISLKRSVMLKTAISVTDDEI--NQSKWTILPYEVKYLIME 396
9634910  398 YIGNKELDIASMK 410
40556089 397 KLSNSDIINIIPK 409
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap