Conserved Protein Domain Family
PHA02874

?
PHA02874: PHA02874 
ankyrin repeat protein; Provisional
Statistics
?
PSSM-Id: 165205
View PSSM: PHA02874
Aligned: 2 rows
Threshold Bit Score: 675.526
Threshold Setting Gi: 40555958
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634915    1 MSVDWRTEIYSGDISLVEKLIKNKGNCINISVEETTTPLIDAIRTGNAKIVELFIKHGAQVNHVNTKIPNPLLTAIKIGS 80 
40555958   2 ASQDLRMCIYSKDLEAIQNIIKTRTNFLNLSVDETVTPLIDAIRSGDVRVVQLLINSGADINHINTNVPHPLLTAIKVRA 81 
9634915   81 HDIVKLLLINGVDTSILPVPCINKEMIKTILDSGVKVNTKNAKSKTFLHYAIKNNDLEVIKMLFEYGADVNIKDDNGCYP 160
40555958  82 NKIIKLLIDNGVDTSVLPIPDLENDTVNTILECGIDVNIRDRELKTFLYYAVKKGDLESVNTLLKYRADVNIEDINGNYP 161
9634915  161 IHIATRSNSYEIIKLLLEKGAYANVKDNYGNSPLHNAAKYGDYACIKLVLDHTNNISNKCNNGVTPLHNAILYNRSAVEL 240
40555958 162 IHIAIKHNFFDIIKVLVENGAYLNVNNYNIETPLHYSVEYGDYKTVKYLITNGSHIMVKCKRGFTPLHTAIIHNRSVIPL 241
9634915  241 LINNRSINDTDVDGYTPLHYALQPPCSIDIIDILLYNNADISIKDNNGRNPIDTAFKYInRDSVIKELLANAVLINEVGK 320
40555958 242 LINNATINVQDINGSTPLHHAINYPCDKDVVDTLLYHKADISIRDNKGENVLDVAMKYV-KMPVLKDIIANAVLKKEADQ 320
9634915  321 LKdTTILEHKEIKDNTVFSNFVYECNEEIKKMKKTKCVGDYSMFDVYMIRYKHKYDGNKDsikdyLRCLDDNSTRmlkti 400
40555958 321 LP-SDFLNKISILENKELSDFIKECNREIEDMKRYTIGCNKNILQLCLNTISINFTNNEQ-----LNTLRSQYHR----- 389
9634915  401 dineFPIYSMYLVRCLYEYGNILKEMGSCIHNRY 434
40555958 390 ----FPIYYMYISRYISDNIKNRNDNNFCSIRNI 419
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap