Conserved Protein Domain Family
PHA02871

?
PHA02871: PHA02871 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165203
View PSSM: PHA02871
Aligned: 4 rows
Threshold Bit Score: 349.301
Threshold Setting Gi: 9634923
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634923    1 MIVEKIAAWLLYPLCLLRCFLCNSVRPATCKCVHCLLYPFEVCCECMSETLDSLEHSCCYCCVLPLLIIREFWRRVILPT 80 
9634938    1 MIVEKIAAWLLYPLCLLRCFLCNSVRPATCKCVHCLLYPFEVCCECMSETLDSLEHSCCYCCVLPLLIIREFWRRVILPT 80 
40555943   1 MIVEKIAAWLLYPLCLLRCFICNSLCPATCKCIHWILYPFEVCCECMSETLDSLEHSCCYICVLPLLIIREFWRRVILPT 80 
40556262   1 MIVEKIAAWLLYPLCLLRCFICNSLCPATCKCIHWILYPFEVCCECMSETLDSLEHSCCYICVLPLLIIREFWRRVILPT 80 
9634923   81 LKATCDCIRLPCVLTRRFCKRTICPLAKSWCRCFCCPCEVFLRCLLFPCMMLRRMHRGRLTGVREPGAFRDSRDPARRGT 160
9634938   81 LKATCDCIRLPCVLTRRFCKRTICPLAKSWCRCFCCPCEVFLRCLLFPCMMLRRMHRGRLTGVREPGAFRDSRDPARRGT 160
40555943  81 LKATWDCLRLPCILTRRFCKRTICPLTKAWCRCFCCPCEVFLRCLCFPCRTLRRLYRGKMTRVREPGASRDSRDPARRGT 160
40556262  81 LKATWDCLRLPCILTRRFCKRTICPLTKAWCRCFCCPCEVFLRCLCFPCRTLRRLYRGKMTRVREPGASRDSRDPARRGT 160
9634923  161 WVNDWCEDLCVWIWSPCCYVKRCIRTMCDTFTKKIFYWFIAPAGSPRMPEEPSPLSRKVFSS 222
9634938  161 WVNDWCEDLCVWIWSPCCYVKRCIRTMCDTFTKKIFYWFIAPAGSPRMPEEPSPLSRKVFSS 222
40555943 161 WVNDWCDDLCIWIWSPCCYVKRWIRTVCDTFTKKFFYWFLVPVGSPRMPDEPSELSRKVFSS 222
40556262 161 WVNDWCDDLCIWIWSPCCYVKRWIRTVCDTFTKKFFYWFLVPVGSPRMPDEPSELSRKVFSS 222
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap