Conserved Protein Domain Family
PHA02869

?
PHA02869: PHA02869 
C4L/C10L-like gene family protein; Provisional
Statistics
?
PSSM-Id: 165202
View PSSM: PHA02869
Aligned: 2 rows
Threshold Bit Score: 877.1
Threshold Setting Gi: 9634936
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634936   1 MEFSCTGTNNQLAVHRFTETRFTSFKKELLVNLGISDLNDIKNICEDSKIFFPEKRTELLSIKDRKSKQIVFENSLNDDL 80 
9634925   1 MEFSCTGTNNQLAVHRFTETRFTSFKKELLVNLGISDLNDIKNICEDSKIFFPEKRTELLSIKDRKSKQIVFENSLNDDL 80 
9634936  81 LKKLHALIYDELSTVVDSVTVENTVTLIMYEKGDYFARHRDFSTVFSKNIICVHLLLYLEQPETGGETVIYIDNNTSVKL 160
9634925  81 LKKLHALIYDELSTVVDSVTVENTVTLIMYEKGDYFARHRDFSTVFSKNIICVHLLLYLEQPETGGETVIYIDNNTSVKL 160
9634936 161 KTDHLFDKTIEHESITVESGRKCVALFDVLLEKKLSASTNVIGSIEYLGKKINLYDRENDLQLCYCDMVIERMTEDKEYS 240
9634925 161 KTDHLFDKTIEHESITVESGRKCVALFDVLLEKKLSASTNVIGSIEYLGKKINLYDRENDLQLCYCDMVIERMTEDKEYS 240
9634936 241 LGMISDRSGRCIKSHHNGSIVRYRKEEYGSFDALCIYNMNEVDEIWTGDKKHIIWSTIDKKTGTSFIPIDPVLYEKLKAI 320
9634925 241 LGMISDRSGRCIKSHHNGSIVRYRKEEYGSFDALCIYNMNEVDEIWTGDKKHIIWSTIDKKTGTSFIPIDPVLYEKLKAI 320
9634936 321 SSKEHKEYKDLRGFCNSRTEYICCSVSKYYFDLPTKTDLIHEVINSIDYDTKSVGTPDWYTLPIEVKQTILGNMSYEELF 400
9634925 321 SSKEHKEYKDLRGFCNSRTEYICCSVSKYYFDLPTKTDLIHEVINSIDYDTKSVGTPDWYTLPIEVKQTILGNMSYEELF 400
9634936 401 NIVRGNIALEEDNEYGCD 418
9634925 401 NIVRGNIALEEDNEYGCD 418
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap