Conserved Protein Domain Family
PHA02867

?
PHA02867: PHA02867 
C-type lectin protein; Provisional
Statistics
?
PSSM-Id: 165201
View PSSM: PHA02867
Aligned: 3 rows
Threshold Bit Score: 139.047
Threshold Setting Gi: 9634933
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634933    1 MPILLKKQVSEVSCYAITVLGILCLILFT-ILVVVTCKWYYAFPYFSKVCPDEWIGYNSKCYYFTINETNWNDSKKLCDV 79 
40555954   1 MVFICKKQYCENKFYFITAFFSISFMFLTaTIIVILIKCYYMFPNFNKVCPDEWIGYKNQCYYFSDNETNWYDSKKKCES 80 
9634934    1 MPILLKKQVSEVSCYAITVLGILCLILFT-ILVVVTCKWYYAFPYFSKVCPDEWIGYNSKCYYFTINETNWNDSKKLCDV 79 
9634933   80 MDSSLIRFDNIETLNFVSRYGKGSYWIDINQNRKIpgINFSLY---YEQGVNDICLLFDTSNIIEMSCIFHERTICVKED 156
40555954  81 MDSSLIKLDRQDVIDFVSKYGKTDYWIERKHYENI--VSTSLYrnsFDINDTSICLYFDLNIITETPCIFYEKWICVKPN 158
9634934   80 MDSSLIRFDNIETLNFVSRYGKGSYWIDINQNRKIpgINFSLY---YEQGVNDICLLFDTSNIIEMSCIFHERTICVKED 156
9634933  157 RYTHWYTEYM 166
40555954 159 NYVVWYYDNH 168
9634934  157 RYTHWYTEYM 166
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap