Conserved Protein Domain Family
PHA02866

?
PHA02866: PHA02866 
Hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165200
View PSSM: PHA02866
Aligned: 6 rows
Threshold Bit Score: 655.128
Threshold Setting Gi: 157939620
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12084984    1 MEVITDGVLRLKSFRDDFKGIKEELKFMLNSWEDSDILRHRQFIPCEILVLEKSERTKQVFGAVKRVLASSLTDYNVYVC 80 
12085134    1 MEVITDGVLRLKSFRDDFKGIKEELKFMLNSWEDSDILRHRQFIPCEILVLEKSERTKQVFGAVKRVLASSLTDYNVYVC 80 
38229170    1 MEVITDGVLRLKIFADEFKNIKEEIKFMLNSWDDSDVLRRRNSIPCEVVAVGKNKRTIPVFDAVKRVLSFSLGDYDVCVG 80 
38229309    1 MEVVTDGVLRLKIFADEFKNIKEEIKFMLNSWDDSDVLRRRNSIPCEVVAVGKNKRTIPVFDAVKRVLSFSLGDYDVCVG 80 
157939620   1 MEVITDGVLRLKSFRDDFKGIKEELKFMLNSWEDSDILRHRQFIPCEILVLEKSERTKQVFGAIKRVLASSLTDYTVYVC 80 
157939775   1 MEVITDGVLRLKSFRDDFKGIKEELKFMLNSWEDSDILRHRQFIPCEILVLEKSERTKQVFGAIKRVLASSLTDYTVYVC 80 
12084984   81 EHLTIVKCFKGVGFDNRFSIIT-EDRHRGREYTLVLHLSSPKNGGKTDVCVGDKTVISTADDFLLEKRSEQLSNVVQEGE 159
12085134   81 EHLTIVKCFKGVGFDNRFSIIT-EDRHRGREYTLVLHLSSPKNGGKTDVCVGDKTVISTADDFLLEKRSEQLSNVVQEGE 159
38229170   81 DHLTVVKCFKGAGFDNRFNILTgDDGRRGVEYSLVVHLSIPEDGGETDICVSGNTVISTTEDFLLEDGCSQLSNVVSEGE 160
38229309   81 DHLTVVKCFKGAGFDNRFNILTgDDGRRGVEYSLVVHLSIPEDGGETDICVSGNTVISTTEDFLLEDGCSQLSNVVSEGE 160
157939620  81 EHLTIVKCFKGVGFDNRFSILT-EDRHRGREYTLVLHLSSQKNGGKTDVCVGDKTVISTADDFLLEKRSEQLSNVVQEGE 159
157939775  81 EHLTIVKCFKGVGFDNRFSILT-EDRHRGREYTLVLHLSSQKNGGKTDVCVGDKTVISTADDFLLEKRSEQLSNVVQEGE 159
12084984  160 KIVVLVKVFLLRKEADVIFTLARFSKDVKFYEKEGDRNLCYALVEVNSPFAEVESFGVITDRSGRCLLVNRYQKLVKKVM 239
12085134  160 KIVVLVKVFLLRKEADVIFTLARFSKDVKFYEKEGDRNLCYALVEVNSPFAEVESFGVITDRSGRCLLVNRYQKLVKKVM 239
38229170  161 KIVAAIKVFLKRKDKDVIFTLARSLRDVKFYDKEGDRDLCYSLVDVNSPFAEVERFGVISDRSGKCLLVNRHQKLVKKAI 240
38229309  161 KIVAAIKVFLKRKDKDVIFTLARSLRDVKFYDKEGDRNLCYSLVDVNSPFAEVERFGVISDRSGKCLLVNRHQKLVKKAI 240
157939620 160 KIAVAVNVFLLRKEADVMFTLARFSKDVKFYEKEGDRNLCYALVEVNSPFAEVESFGVITDRSGRCLLVNRYQKLVKKVM 239
157939775 160 KIAVAVNVFLLRKEADVMFTLARFSKDVKFYEKEGDRNLCYALVEVNSPFAEVESFGVITDRSGRCLLVNRYQKLVKKVM 239
12084984  240 VEKTFVDMCTEISFDGFYNLSNVEGKDMAWKELKAVKEDLWVPSSEEDYKFLRELVDYVSSNLKTKVDYYVLSTCDDDET 319
12085134  240 VEKTFVDMCTEISFDGFYNLSNVEGKDMAWKELKAVKEDLWVPSSEEDYKFLRELVDYVSSNLKTKVDYYVLSTCDDDET 319
38229170  241 VEKTFADMCAEIAFEGFYDLVNVDGKDVAWKELGAVEEDIWVPSSEDDYSFLKELVDHVSCNLKTKVGYYVLSTC-DDET 319
38229309  241 VEKTFADMCAEIAFEGFYDLVNVDGKDVAWKELGAVEEDIWVPSSEDDYSFLKELVDHVSCNLKTKVGYYVLSTC-DDET 319
157939620 240 VEKTFVDMCTEISFDGFYNLSNVEGKDMAWKELKAVKEDLWVPSSEEDYKFLRELVDYVSSNLKTKVEYYVLSTCDDDET 319
157939775 240 VEKTFVDMCTEISFDGFYNLSNVEGKDMAWKELKAVKEDLWVPSSEEDYKFLRELVDYVSSNLKTKVEYYVLSTCDDDET 319
12084984  320 QYVSLNVIRCYFSI 333
12085134  320 QYVSLNVIRCYFSI 333
38229170  320 LYVSFNVIRCYFSM 333
38229309  320 LYVSFNVIRCYFSM 333
157939620 320 QYVSLNVIRCYFSI 333
157939775 320 QYVSLNVIRCYFSI 333
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap