Conserved Protein Domain Family
PHA02865

?
PHA02865: PHA02865 
MHC-like TNF binding protein; Provisional
Statistics
?
PSSM-Id: 165199
View PSSM: PHA02865
Aligned: 7 rows
Threshold Bit Score: 567.955
Threshold Setting Gi: 12084985
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38229171    1 MNKLILSLLGFVATCNCIT-LRYNYTVTVKN---GLYDGVFFDYYNDQLVTRISYNHET-RHGNVNSRASWFDISKSPHT 75 
211956282   1 MKKLIFILLSIIAYSEAARfLVYNYTFTKHDkttGKKEFDVTDTFDDILIKKFKLNHETgGPEQKNMVPTWFNETKIKYY 80 
157939621   1 -MNKLILFSTIVAVCNCIT-LKYNYTVTLKDn--GLYDGVFYDHYNDQLVTKISYNHET-RHGNVNFRADWFNISRSPHT 75 
62637387    1 MKKLILILLSIIAYSEAARyLVYNYTFTRYDkttGKKEFDVTDTFNNVLIKHYKLNHETgRPEQKHTIPKWFNETKIKHY 80 
18640089    2 ITKAIVILSIITAYVDASAfLVYNYTYTLQDd-nHRYDFEVTDYFNDILIKRLKLNSETgRPELRNEPPTWFNETKIRYY 80 
18640234    2 ITKAIVILSIITAYVDASAfLVYNYTYTLQDd-nHRYDFEVTDYFNDILIKRLKLNSETgRPELRNEPPTWFNETKIRYY 80 
12084985    1 -MDKLLLFSTIVAVCNCIT-LKYNYTVTLKDd--GLYDGVFYDHYNDQLVTKISYNHET-RHGNVNFRADWFNISRSPHT 75 
38229171   76 PGDDYHFNFWYPLMKDTLESINSNknESDKCSSLSLILGCYETGSLFGSYGYVESSGGPLARYSTKDKKFLKMTDKGFPK 155
211956282  81 PTDNYHYNFWLNQLENTLDEINKV--KGTNYNRFSLIVGCTDLIQLYTHFGYVELEYDILARFDTTNKRFSKVRSHGFPK 158
157939621  76 PGNDYNFNFWYSLMKETLEEINKN--DSTKTTSLSLITGCYETGLLFGSYGYVETANGPLARYHTGDKRFTKMTHKGFPK 153
62637387   81 PKDDYHYSFWLGQLENTLSEINKL--EGNKHESISLIVGCTDLIQLYTQFGYVEVDGKILTRFDTKNKRFTKVKSHTFPK 158
18640089   81 PKNNYNFMFWLNRMSETLDEINKLpeTSNPYKTMSLTIGCTDLRQLQVNFGYVTVGGNIWTRFDPKNKRFSKVRSRTFPK 160
18640234   81 PKNNYNFMFWLNRMSETLDEINKLpeTSNPYKTMSLTIGCTDLRQLQVNFGYVTVGGNIWTRFDPKNKRFSKVRSRTFPK 160
12084985   76 PGNDYNFNFWYSLMKETLEEINKN--DSTKTTSLSLITGCYETGLLFGSYGYVETANGPLARYHTGDKRFTKMTHKGFPK 153
38229171  156 VGMLTVHGPSWQTVKKYVGGFVYAGCLLAIFDYQKMAKNNIPSNVMPTVTVTGEELQDgNTTLKCNVKSFYPPDVMIKWI 235
211956282 159 VGMLTVNSPFWGDIMKYFGSIVALTCGITANDYWKLAKGHIPPPVAPNIKVTGEEKGE-NTTLFCKFDKHYPSSVAAKWY 237
157939621 154 VGMLTVKNTLWKDVKTYLGGFEYMGCSLAILDYQKMAKGEIPKDTTPTVKVTGNELEDgNMTLECSVNSFYPPDVITKWI 233
62637387  159 VGMLTVTSPFWNDIMKYFGSIVAVTCGITANDYWKLAKGNIPSPVEPKIKVTGKEKGE-NTTLFCDFDKHNPSSVAAKWY 237
18640089  161 VGMLTVKSQHWERVMEHLGSMVTLTCPFTADDYYKISKGYIDKPVKPTVTVTGIERGD-NTTLICTFDNHYPSSVAVKWY 239
18640234  161 VGMLTVKSQHWERVMEHLGSMVTLTCPFTADDYYKISKGYIDKPVKPTVTVTGIERGD-NTTLICTFDNHYPSSVAVKWY 239
12084985  154 VGMLTVKNTLWKDVKAYLGGFEYMGCSLAILDYQKMAKGKIPKDTTPTVKVTGNELEDgNMTLECTVNSFYPPDVITKWI 233
38229171  236 ESKYFNGEYRYvnGREYPEWGRQSDYEPGEPGFPLHPKKDDGKt-TYSLLDFGRTTSGLTSQLVCVVFHDTFESQVNTCS 314
211956282 238 NLEDMAPDYTW--SKYFSELVVNTDYNPGEPGFPTNTHMINAT--LFSSVPSIVVPTDMSNKIVCVAFHSTIQPVIHRCQ 313
157939621 234 ESEHFKGEYKYvnGRYYPEWGRKSDYEPGEPGFPWNIKKDKDAn-TYSLTDLVRTTSKMSSQLVCVVFHDTLEAQVYTCS 312
62637387  238 NLEDLAPTYRW--SRYFTELIVDTDYNPGEPGFPTNTRIINETalVFASTPSIVVPTDMSNKIVCVGFHSTIQPSIHRCE 315
18640089  240 NIEDFAPDYRY--DPYVNELLPDTDYLPGEPGYPTITRRLGDKy-LFTSSPRVMVPTIMSNRIACVGFHSTLEPSIYRCV 316
18640234  240 NIEDFAPDYRY--DPYVNELLPDTDYLPGEPGYPTITRRLGDKy-LFTSSPRVMVPTIMSNRIACVGFHSTLEPSIYRCV 316
12084985  234 ESEHFKGEYKYvnGRYYPEWGRKSNYEPGEPGFPWNIKKDKDAn-TYSLTDLVRTTSKMSSQPVCVVFHDTLEAQVYTCS 312
38229171  315 EGCEGKLYDHLYRKSEEGdevVEDEED 341
211956282 314 EGCNGPYPIMQYKGDIKS---SVDEED 337
157939621 313 EGCNGELYDHLYRKTEEGe-gEEDEED 338
62637387  316 EGCNGPEPIMQYQGDVKSs--IDDEED 340
18640089  317 N-CSGPEPVLQYQGDRRNd--LEDEED 340
18640234  317 N-CSGPEPVLQYQGDRRNd--LEDEED 340
12084985  313 EGCNGELYDHLYRKTEEGe-gEEDEED 338
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap