Conserved Protein Domain Family
PHA02862

?
PHA02862: PHA02862 
5L protein; Provisional
Statistics
?
PSSM-Id: 165197
View PSSM: PHA02862
Aligned: 3 rows
Threshold Bit Score: 238.309
Threshold Setting Gi: 12084988
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157939624   1 MSDICWICNDVCDERNNFCGCNEEYKVVHIKCMQLWINYSKKKECNLCKTKYNIKKTYVSFKKWNWCFNDKKTTLLKIFF 80 
38229173    1 MSNICWICNDTCDERNNFCICSEEYKIVHLKCMQSWINYSKKVECDLCKNKYNIKKSYHYFSRWKWCFSDKKTVLSKILF 80 
12084988    1 MSDICWICNDVCDERNNFCGCNEEYKVVHIKCMQLWINYSKKKECNLCKTKYNIKKTYVSFKKWNWCFNDKKTTLFKIFF 80 
157939624  81 ILFALVFIFLTIALSNDMADLITGINDIICSIIFLIVYTVVMLTSICFSVFVVAIVVDFLLEAKEKNSFLTIREIV 156
38229173   81 IFFAVGFIFITTSMSSNVASLVTRIDDTFFDVVFLTVYISMILVTVCLCVFVLALAVDFLLDAKEKNSFLTIKEIV 156
12084988   81 ILFALVFIFLTITLSNDMANLVTGINDLICSIIFLIVYTVVMLTSICFSVFVVAIVVDFLLEAKEKNSFLTIREIV 156
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap