Conserved Protein Domain Family
PHA02861

?
PHA02861: PHA02861 
uncharacterized protein; Provisional
Statistics
?
PSSM-Id: 165196
View PSSM: PHA02861
Aligned: 3 rows
Threshold Bit Score: 293.448
Threshold Setting Gi: 157939625
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12084989    1 MEFCPGYCLVDCLNRDDDIRQIIVDYIYWSMYSYRSRSPAGKVFQVLKMFRRDSEIVFGENFRHIVKNFKTLGIEDTVQA 80 
38229174    1 MDFCPGYCLVDCLNRNDNIHQIIVDYIYWSMYAYRRRSPAGKVFRVLKTFRKDSEMVFGENFRHIVENFKTLGVENTAQA 80 
157939625   1 MEFCPGYCLVDCLNGDDDIRQIIVDYIYWSMYSYRSRSPAGKVFQVLKMFRRDSEIVFGENFRHIVKNFKTLGIEDTVQA 80 
12084989   81 VKCFTIGKNALRESVSMVDLCASLAEYWGGEDLPTNDSLQALKLMTILLSDDDYSFIDLCLRVRLKKLK 149
38229174   81 VKCFTVGKNALREAVAMVDLCASLADYWGGEDLPTDDSLQALRLMTMILSDVDYPFIELCLKVRLNKLK 149
157939625  81 VKCFTVGKNALRESVSMVDLCASLAEYWGGEDLPTNDSLQALKLMTILLSDDDYSFINLCLRVRLKKLE 149
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap