Conserved Protein Domain Family
PHA02859

?
PHA02859: PHA02859 
ankyrin repeat protein; Provisional
Statistics
?
PSSM-Id: 165195
View PSSM: PHA02859
Aligned: 7 rows
Threshold Bit Score: 278.626
Threshold Setting Gi: 15150451
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
211956288   1 MDIMSEECNfMDQVDYMFSKYSNPLFYYIESGDEEGVKKWIKLSNENNDFNEPPILSCLDQEYVNKNILKLLIENGANVN 80 
148912890   3 KEKLCSEYD-NDFTDYLFYRYCNPLFYYVEKDDINGVKKWIKFVNDCNDLYETPLFSCVEKDKVNVEILKFLIENVSDIN 81 
157939627   3 EERFT---DyDEFIDDLFVSYTNPIFYYVWKNDIENVKKWSCFVNTFNEYYETPIHTCLENKNASLEMVEFLIKSGADVN 79 
62637393    1 MDMMSKECDfMDQVDYMFSKYSNPLFYYIESDDEEGVKKWINLSNENNDFNEPPILSCLDKEYVNKNILKLLIENGANVN 80 
12084991    3 EERFT---DyDEFIDNLFVSYTNPIFYYVWKNDIENVKKWSCFANKFNEYYETPIHTCLENKNASLEMVEFLIKSGADVN 79 
21492467    3 KEKLCSEYD-NDFTDYLFYRYCNPLFYYVEQDDINGVKRWIKFVNDCNDLYETPLFSCVEKDKVNVEILKFLIKNGSNIN 81 
15150451    3 KEKLCSDYD-NDFTDYLFYRYCNPLFYYVEQDDINGVKKWIKFVNDCNDLYETPLFSCVEKDKVNVEILNFLIENGSDIN 81 
211956288  81 CIIPGENISLLSYYLTYNKNVSEEILKILIDANANINEINSDGKNLLHVYLDNISVNVEIMKFLIEMGNSPFNKDKHCNN 160
148912890  82 FKTRDNNLSALGHYLSFNKNVEPEIVKILIDSGSSVTEEDENGKNLLHMYMCNFNVRINVIKLLIDSGVNFLQKDFDNNN 161
157939627  80 HKTKHYGFSPLHSYLSINENVNIDILQLMVKNGSDIESLDEDGKTPFHRYMTNCNVKIDVVKYLYKLGCSIYNIDNDGNN 159
62637393   81 CIIPGDNISLLSYYLTYNKNISEEILKILIEANANINEINSDGKNLLHVYLDNISINVEIMKFLIEMGNSPFNKDKHQNN 160
12084991   80 HKTKHYGFSPLHTYLSINENVNIDILQLMVKNGSDIESLDEDGKTPFHRYMTNCNVKIDVVKYLYKLGCSIHNIDHDGNN 159
21492467   82 FKTRDNNLSALGHYLSFNKNVEPEIVKILIDSGSSVTEEDENGKNLLHMYMCNFNVRINVIKLLIDSGVNFLQKDFDNNN 161
15150451   82 FKTRDNNLSALAHYLSFNKNVEPEIVKILIDSGSSITEEDENGKNLLHMYMCNFNVRINVIKLLIDSGVNFLQKDFDNNN 161
211956288 161 ILYTYLMYHDDQKIVDFLVSIGLDYEECNNMGLNCIDISKNRGI-VFNKD 209
148912890 162 ILYSYILFHSDKKIFDYLTSLGIDIYETNTSGYNCNDLIKFRNLtFFGKQ 211
157939627 160 MLHSYFLLRSEDEISNFLIEEGVDINSVNKYGVTPYQLKNYNKV-FLNKT 208
62637393  161 ILYTYLMYHDDQKIVDFLLSIGLDYEECNNMGLNCIDISKNRDI-IFNKD 209
12084991  160 MLHSYFLLRSEDEISNFLIEEGVDINNVNKYGVTPYQLKNYNKV-FLNKT 208
21492467  162 ILYSYILFHSDKKIFDYLTSLGIDIDETNKSGYNCKDLIKFRNLtFFDKQ 211
15150451  162 ILYSYILFHSDKKIFDYLTSLGIDMDETNTSGYNCKDLIKFRNLtFFDKQ 211
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap