Conserved Protein Domain Family
PHA02858

?
PHA02858: PHA02858 
EIF2a-like PKR inhibitor; Provisional
Statistics
?
PSSM-Id: 165194
View PSSM: PHA02858
Aligned: 9 rows
Threshold Bit Score: 117.896
Threshold Setting Gi: 148912891
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18640096   1 MSTMNTLAFCYGLPNINDITQGIIFVRNNIFYSYLTDYAMEACILNYINIRADKIEDLKKSLVGKTISVRVIRVDVLKGY 80 
15150453   1 MSSNSDLAFCYVLPNINEVTDGIVFIKDNIVYVKLINYGLEALVIDYVNINMDQMNNIKKTLVNKLINVQIIRMNKIKGY 80 
21492468   1 MSSNSDLAFCYVLPNINEVTDGIVCIRDNIVYVKLINYGLEALVIDYVNINMDQMNNIKKTLVNKLINVQIIRMNKIKGY 80 
12084995   2 NNYKSKLAFCYAFPTVGTVTKGIVTVKDADFTVFLPEFGLEALIVNYFSVNANIAEKLSKELSGKTINVQVIRTDKLKGY 81 
38229177   2 SRNRSQLAFCYAFPTVGTITKGVVTVEGDSFTVFLPEFGLHALIVNYLSVNVKRAKKLSEKLSGKTVTVQVIRTDKLKGY 81 
62637399   1 MSRKSDLAFCYVFPEIDELTKGIVILKNGELYVKLIDYGLDGFIVDYWNVNQERFEKIRKKLVGKVIKVKVIRTDKVKGY 80 
157939632  2 NNHKSKLAFCYAFPTVGTVTKGIVTVKDADFTVFLPEFGLEALIVNYFSVNANIAEKLSKELSGKTINVQVIRTDKLKGY 81 
148912891  1 MSSNSDLAFCYVLPNINEVTDGIVFIKDNIVYVKLINYGLEALVIDYVDINMDQMNNIKKTLVNKLINVQIVRMNKIKGY 80 
211956294  1 MSQKSDLAFCYVFPEIDELTKGIVILKNGELYVKLIDYGLDGFIIDYWNVNQERFEKIRKKLVGKVIKVKVIRTDKVKGY 80 
18640096  81 IDVSIV 86 
15150453  81 IDVKVY 86 
21492468  81 IDVKIY 86 
12084995  82 VDVRHI 87 
38229177  82 VDVRHI 87 
62637399  81 IDVRKV 86 
157939632 82 VDVRHI 87 
148912891 81 IDVKVH 86 
211956294 81 IDVRKV 86 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap