Conserved Protein Domain Family
PHA02857

?
PHA02857: PHA02857 
monoglyceride lipase; Provisional
Statistics
?
PSSM-Id: 165193
View PSSM: PHA02857
Aligned: 7 rows
Threshold Bit Score: 450.492
Threshold Setting Gi: 38229178
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38229178    1 MINCFINSSGSFISCKYWFFSPIPKAIVFISHGEGEHSLIYENLANELTKINIAVFSHDHIGHGKSQGERLSVTSFNVYL 80 
157939633   1 MIHYFINKGGKFISCKYWCFSPIPKAIVFISHGEGEHSLIYERLANELTKINISVFSHDHVGHGKSQGKRLSVTSFNVYI 80 
113195216   3 SANCMFNLDNDYIYCKYWKPITYPKALVFISHGAGEHSGRYEELAENISSLGILVFSHDHIGHGRSNGEKMMIDDFGTYV 82 
12084996    1 MIHYFINKGGKFISCKYWCFSPIPKAIVFISHGEGEHSLIYERLANELTKINISVFSHDHVGHGKSQGKRLSVTSFNVYI 80 
22164762    2 SANCMFNLDNDYIYCKYWKPITYPKALVFISHGAGEHSGRYDELAENISSLGILVFSHDHIGHGRSNGEKMMIDDFGTYV 81 
20178413    2 SANCMFNLDNDYIYCKYWKPITYPKALVFISHGAGEHSGRYDELAENISSLGILVFSHDHIGHGRSNGEKMMIDDFGTYV 81 
17974944    2 SANCMFNLDNDYIYCKYWKPITYPKALVFISHGAGEHSGRYDELAENISSLGILVFSHDHIGHGRSNGEKMMIDDFGKYV 81 
38229178   81 QDVMQHVGIFKRVYPNVPMFVLGHSMGSAIAILTSAKYPNIFDGVILLSPMINfSEKLSFCDIIKTYLCNIFYPSKIIHK 160
157939633  81 QDVIQHVNIFKKSYPNVPMYILGHSMGSAIAILISVKYPNIFDGIILLSPMINfLENLSFCDILKTYLYNIFYPSKIIYK 160
113195216  83 RDVVQHVVTIKSTYPGVPVFLLGHSMGATISILTAYENPNLFTAMILMSPLVN-AEAVPRLNLLAAKLMGAIAPNAPVGK 161
12084996   81 QDVIQHVNIFKKSYPNVPMYILGHSMGSAIAILISVKYPNIFDGIILLSPMINfLENLSFCDVLKTYLYNIFYPSKIIYK 160
22164762   82 RDVVQHVVTIKSTYPGVPVFLLGHSMGATISILAAYENPNLFTAMILMSPLVN-ADAVPRLNLLAAKLMGTITPNVSVGK 160
20178413   82 RDVVQHVVTIKSTYPGVPVFLLGHSMGATISILAAYENPDLFTAMILMSPLVN-TEAVPRLNMLAAKLMGSFTPNAPVGK 160
17974944   82 RDVVQHVVTIKSTYPGVPVFLLGHSMGATISILAACDNPNLFTAMILMSPLVN-ADAVPRLNLLAAKLMGTITPNASVGK 160
38229178  161 INVNLLSNNKEENLLYNSDPYVCGNcGMSASFCYQMMRLTSKVKKKIKNVKIPIMVLHGTDNSVCDVKWSMYVVKSVKSh 240
157939633 161 INVNMLSNNIKENASYNLDPYICSN-KMSAAFCYQVMCLTSSAKKKINNVKIPIIVLHGINDVICDVKWSKYIIKSVGSy 239
113195216 162 LCPESVSRDMDEVYKYQYDPLVNHE-KIKAGFASHVLKATNKVRKIIPKINTPSLILQGTNNEISDVSGAYYFMQHANC- 239
12084996  161 INVNMLSNNIKENASYNLDPYICSN-KMSAAFCYQVMCLTSSAKKKINNVKIPIIVLHGINDVICDVKWSKYIIKSVGSy 239
22164762  161 LCPESVSRDKDEVYKYQYDPLVNHE-KIKAGFASQVLKATNKVRKIIPKINTPTLILQGTNNEISDVSGAYYFMQHANC- 238
20178413  161 LCPESVSRDMDEVYKYQYDPLVNHE-KIKAGFASQVLKATNKVRKIIPKINTPSLILQGTNNEISDVSGAYYFMQHANC- 238
17974944  161 LCPESVSRDMDEVYKYQYDPLVNHE-KIKAGFASQVLKATNKVRKIIPKIDTPTLILQGTNNEISDVSGAYYFMQHANC- 238
38229178  241 DITIKMYKGAKHDLHREKINIRDSVFNDIIAWLMNKSNI 279
157939633 240 DRTIKLYKGANHDLHREVEDIRDTVFSDIKVWLINRSKV 278
113195216 240 NREIKIYEGAKHHLHKETDEVKKSVMKEIETWIFNRVK- 277
12084996  240 DRTIKLYKGANHDLHREVEDIRDTVFSDIKVWLINRSKV 278
22164762  239 NREIKIYEGAKHHLHKETDEVKKSVMKEIETWIFNRVKL 277
20178413  239 NREIKIYEGAKHHLHKETDEVKKSVMKEIETWIFNRVK- 276
17974944  239 NREIKIYEGAKHHLHKETDEVKKSVMKEIETWIFNRVK- 276
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap