Conserved Protein Domain Family
PHA02854

?
PHA02854: PHA02854 
putative host range protein; Provisional
Statistics
?
PSSM-Id: 165191
View PSSM: PHA02854
Aligned: 4 rows
Threshold Bit Score: 250.964
Threshold Setting Gi: 18640150
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18640150    1 MGITHELDIFLVSEDIAMKHVELHKGNSYGCVLNIKSSCRKQMKIIFVLKPDWTEIDSIKPIQMEADGIYIDVTIIKQSF 80 
157939690   1 MGVTHELDIFVTNEDLALKNVELCKGNSYGCFINLKVKEEKKFNIIFVLKPDWSEVDKVKPIRMLVNNNSVDVEKVSESL 80 
38229229    1 MGITHELDIFVTNEDLALKNIELFKGNSYGCFINLKVKEEKRFNMIFVLRPDWSEIDSVKPIRMTVNNNHVDVEKVSESI 80 
12085050    1 MGITHELDIFVTNEDLALKNVELFKGNSYGCFINLKVKEEKKFNIIFVLKPDWSEVDKVKPIRMIVNNNSVDVEKVSESL 80 
18640150   81 YEVIYCSNFTIYGDSVINIFSDIDRCTKEKYPIININIDKKKYEIIESGYTYIYIQSPIDKEDKLTYMRDDYvdEYNSSD 160
157939690  81 YQVVYSASFSINSDSYVKVFSDNPDKYKHMYPTVTINVTKKKFKVVDQGNTYMFIQSPIDDCDKEQFLKNEF--EYYDGE 158
38229229   81 HEVVYSASFLISFNSLVKVFSDDPDKYKNVYPTVTINVPKKKFKVVDQGNTYMFIQYPIDDCDKERFLKDEF--KYC--D 156
12085050   81 YQVVYSASFSINSDSYVKVFSDNPDKYKHMYPTVTINVPKKKFKVVDQGNTYMFIQSPIDDCDKEQFLKNEF--EYYDEE 158
18640150  161 DDCIDYYDCDYDDDDNNDAE 180
157939690 159 NDFDDYEEYVKNRNDSFDDY 178
38229229  157 NEYDQYNDCDE--------- 167
12085050  159 NDFDDYEEYVKNRNDSFDDY 178
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap