Conserved Protein Domain Family
PHA02852

?
PHA02852: PHA02852 
putative virion structural protein; Provisional
Statistics
?
PSSM-Id: 165190
View PSSM: PHA02852
Aligned: 3 rows
Threshold Bit Score: 232.952
Threshold Setting Gi: 157939703
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12085063    1 MDQIKKINDIIQNCNAVFSNEVNLLYNEKFIFLEKNLNGLPFKAHIYNNVSRFDNKTIFRVVKYVYKNRPKILKLIFPNN 80 
38229242    1 MEQVKKINSIIQNCNAVFLNEINLLFNEHFIFLERNSNGLPFKAHVYNNLLRFDNKTIFRAVKFIYGNRPQIIKLIFPNN 80 
157939703   1 MDQIKKINDIIQNCNAVFSNEVNLLYNEKFIFLEKNLNGLPFKAHIYNNVSRFDNKTIFRVVKYVYKNRPKILKLIFPNN 80 
12085063   81 SFFESLEPLLPVKTINLSYNNTINDDLQDNTLSTKMILLELFNSFKFGKGSNYLVKYPYYYLPLRKDINDIVT 153
38229242   81 SFFESLEPLLPVKTVNLYYDNSVNNDIQDNPLSVKIILLDLFNSFKIGKKDNDLLRYPHYYLPLRKNINDVIT 153
157939703  81 SFFESLEPLLPVKTINLSYNNTINDDLQDNTLSTKMILLELFNSFKFGKESNYLVKYPYYYLPLRKDINDIVT 153
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap