Conserved Protein Domain Family
PHA02851

?
PHA02851: PHA02851 
EEV glycoprotein; Provisional
Statistics
?
PSSM-Id: 165189
View PSSM: PHA02851
Aligned: 2 rows
Threshold Bit Score: 338.631
Threshold Setting Gi: 12085109
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157939750   1 MIIPYIIVSCSLIILIVYLFLINKKYCKKFFKKKNKPVCIELKKIINTNKTLTLNSEDWTDMGSCEIYANFRSSKREKSF 80 
12085109    1 MIIPYIIVSCSLIILIVYLFLINKKYCKKFLKKKNKPVCIELKKITNTNKTSTLNSEDWTDMGSCEIYANFRSSKREKSF 80 
157939750  81 KLKDEQQNSSSTSSGDSEFDSTINTDDESEKLNWDNEEYKYDYDKSESTVYDLPQDNIAENTVYDVTDNVENITYDLPQD 160
12085109   81 KLKDEQQNSSSTSSSDSEFDSTINTDDESEKLNWDNEEYKYDYGKSESTVYDLPQDNITEDTVYDVTDNVENITYDLPQD 160
157939750 161 SIIYNLDEKSDVAVYDIPELEDSVYENNICLESCFDDVKYNSPLNNFNKNYYSYNTNDFVSNV 223
12085109  161 SIIYDLDGKSDVAVYDIPESEDNVYENNICLESCFDDVKYNSPLNNFNKNYYSYNTNDFVSNV 223
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap