Conserved Protein Domain Family
PHA02849

?
PHA02849: PHA02849 
putative transmembrane protein; Provisional
Statistics
?
PSSM-Id: 165188
View PSSM: PHA02849
Aligned: 3 rows
Threshold Bit Score: 118.486
Threshold Setting Gi: 157939641
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12085004   1 MNNTKHLNDIEFDAGAVTVILVFVLVISFLACMLLYLIKWSYVINFLNDMKIKLINLTTRRSFTHLNNVYYTSDNIVGLN 80 
38229184   1 MNSTINFEDSEFGANMVMVISVFVLMISFLVFMLLYLIKWSYVMGFLNDVKIKIMNMTTRRSFAHLDDIYYTSDDVIGLN 80 
157939641  4 MNNTKHLNDIEFDAGAVTVILVFVLVISFLAFMLLYLIKWSYVINFLNDMKIKLINLTTRRSFTHLNNVYYTSDNIVGLN 83 
12085004  81 TD 82 
38229184  81 VE 82 
157939641 84 TD 85 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap