Conserved Protein Domain Family
PHA02845

?
PHA02845: PHA02845 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165187
View PSSM: PHA02845
Aligned: 4 rows
Threshold Bit Score: 83.6221
Threshold Setting Gi: 157939684
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157939684  1 MAEVLFSKLKSIERENLLNESILDCIINEIENNHHYLFRSFIRLTIDLILLIIAMIFIMIRILKRNYFALFVIFLFYLFI 80 
38229223   1 MAEVLFFKLKSIEQENLLNGLILDCIINEIENSNHYLLRPFIRLIIDVILLITVIVSLIIRILKRNYVTLLIMFLFYLSM 80 
12085044   1 MAEVLFSKLKSIERENLLNESILDCIINEIENNHHYLFRSFIRLTIDLILLIIAMIFIMIRILKRNYFALFVIFLFYLFI 80 
18640144   1 MAEVLINKLRSIEYENKSNEKLIDCILYEVERQQHWVFRPILRLLFDMIILLIVFNDLLFRLIKRNYYICIILITTYIMY 80 
157939684 81 SFRNQIAIVFN 91 
38229223  81 RFKNQIAIVFN 91 
12085044  81 SFRNQIAIVFN 91 
18640144  81 KFFMYILLLYN 91 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap