Conserved Protein Domain Family
PHA02844

?
PHA02844: PHA02844 
putative transmembrane protein; Provisional
Statistics
?
PSSM-Id: 165186
View PSSM: PHA02844
Aligned: 3 rows
Threshold Bit Score: 113.21
Threshold Setting Gi: 38229206
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12085027   1 MDKLYTAIFGVFLSSENEDFNNFIDVVKSVLSDdyDGVNKNNNCSSSTKIWILTIIFVVFATFLTFLYLKAIPRT 75 
38229206   1 MDKLYTAIFGAFLSSEDEDFNNFIDVVRSVLTD--DNIASKNVCSSGTKIWIITIIFVVLAVFLTFLYLKAVPRT 73 
157939667  1 MDKLYTAIFGVFLSSENEDFNNFIDVVKSVLSDdyDGVNKNN-CSSSTKIWILTIIFVVFATFLTFLYLKAMPRT 74 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap