Conserved Protein Domain Family
PHA02843

?
PHA02843: PHA02843 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165185
View PSSM: PHA02843
Aligned: 2 rows
Threshold Bit Score: 79.0751
Threshold Setting Gi: 12085006
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157939643  1 MGNCSRKQNKNIKTSDDYDYYLDNFLDNEYFKFSCTNVNNNKLknKNKNHTRRNNNNTIDSRKSYCSIKSVYF 73 
12085006   1 MGNCSRKQNKNIKTSDDYDYYLDNFLDNEYFKFSCTNVNNNKL--KNKNHTRRNNNNTIDSRKSYCSIKSVYF 71 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap