Conserved Protein Domain Family
PHA02841

?
PHA02841: PHA02841 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165184
View PSSM: PHA02841
Aligned: 2 rows
Threshold Bit Score: 176.006
Threshold Setting Gi: 12085005
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12085005    1 MGDKYVKSIKRKIYSLNFFKKTFKKTYSPCKEIGVTSINNYGIFTHEQQMLLDEDNDQQILIDENDDQQMLINDEQNIFS 80 
157939642   1 MGDKYVKSIKRKIYSLNFFNKTFKKTYSPCKEIGVTSINNYGIFTHEQQMLLDEDNDQQILIDENDDQQMLINDEQNIFS 80 
12085005   81 FKIIKKPYKVIRFMGNGDDEVFI 103
157939642  81 FKIIKRPYKVIRFMGNGDDEVFI 103
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap