Conserved Protein Domain Family
PHA02840

?
PHA02840: PHA02840 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165183
View PSSM: PHA02840
Aligned: 3 rows
Threshold Bit Score: 75.5837
Threshold Setting Gi: 38229294
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38229294   1 METEFLSVKVTSDSGNAISVYCETKSNVSIDITTKNNSSNvVNTALKKVKKKVSSRDIKSKKLKPSSTDEEHDNSMEIDS 80 
157939756  1 METEFLSVKITSNSGNTISIYCETKTTVSIDITTKKNVDN-VNTTLKKVKKKEITKNEEPKKNETSSDNEDSDNAMEIDS 79 
12085115   1 METEFLSVKITSNSGNTISIYCETKTTVSIDITTKKNVDN-VNTTLKKVKKKELTKNEEPKKNETSSDNEDSDNAMEIDS 79 
38229294  81 DTD 83 
157939756 80 NKE 82 
12085115  80 NKE 82 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap