Conserved Protein Domain Family
PHA02839

?
PHA02839: PHA02839 
Il-24-like protein; Provisional
Statistics
?
PSSM-Id: 165182
View PSSM: PHA02839
Aligned: 2 rows
Threshold Bit Score: 222.938
Threshold Setting Gi: 12085117
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12085117    1 MKLYFYCIFFYKIIVTISLNCGIEHNELNNIKNIFFKVRNVVQADDVDHNLRILTPALLNNITVSETCFFIYDMFELYLN 80 
157939758   1 MKLYFYCIFFYKIIVTISLNCGIEHNELNNIKNIFFKVRNVVQADDVDHNLRILTPALLNNITVSETCFFIYDMFELYLN 80 
12085117   81 DVFVKYTNTALKLNILKSLSSVANNFLAIFNKVKKRRVKKNNVNVLEIKKLLLIDNNCKKLFSEIDIFLTWVMAKI 156
157939758  81 DVFVKYTNTALKLNILKSLSSVANNFLAIFNKVKKRRVKKNTVNVLEIKKLLLIDNNCKKLFSEIDIFLTWVMAKI 156
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap