Conserved Protein Domain Family
PHA02838

?
PHA02838: PHA02838 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165181
View PSSM: PHA02838
Aligned: 3 rows
Threshold Bit Score: 68.1465
Threshold Setting Gi: 12085114
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157939755  1 MSLTTLSMTITIKEDSVNIMGSVPIKDNSNININILKENKKIDKNENLYIVTSDTDTISNDDTEKNKK 68 
12085114   1 MSLTTLNMTITIKEDSVNIMGSVPIKDNSNININILKENKKIDKNENLYIVSSDTDTISNDDTEKNKK 68 
38229293   1 MCSTTITITITIKEDNTNMIGFIPTRDNSNIDINVRENNACKLKKDDVFYTVDENDTIINKHTKERKN 68 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap