Conserved Protein Domain Family
PHA02837

?
PHA02837: PHA02837 
uncharacterized protein; Provisional
Statistics
?
PSSM-Id: 165180
View PSSM: PHA02837
Aligned: 3 rows
Threshold Bit Score: 313.799
Threshold Setting Gi: 38229298
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12085122    1 MIKITVSDKKVTIESNDEFSFLLTH--NNGILNNCNFVnnIEKSYLLNDEIQDSDNIFNIISNYLWYRGFVGLEHSKCGR 78 
38229298    6 NIKVIITDKNVTIEMDNDNVPVLVKsiNYDDVFDCDVV--MQKNYVLKDEICDNDNIFNIISNYLWYRGFIGLGNGKYGR 83 
157939763   1 MIKITVSDKKVTIESNNEFSFLLTH--NNGILNNCNFVnnIEKSYLLNDEIQDSDNIFNIISNYLWYRGFIGLEHSKCGR 78 
12085122   79 LFKELLRFDLEAKRKYGSVKTIFNILNLDSNDGIFNLKKFILLQRTITKDFNVYHCIEIIGLCGIIVEEWKKMGRYLNWL 158
38229298   84 LFKELLCFDLEAKRKYGSVKTMFNMLNLDSEDGIVNLKKFILFQKTITKDFSVYHCTEIIGLCGIVVEEWKKMGRCLNWL 163
157939763  79 LFKELLRFDLEAKRKYGSVKTIFNILNLDSNNGIFNLKKFILLQKTITKDFNVYHCIEIIGLCGIIVEEWKKMGRYLNWL 158
12085122  159 NiSNNIFKALGLNVFTDLKIFLQNRLLYEELI 190
38229298  164 N-TNDIFKVLDVKVLEELKKFLQNKLLYEELI 194
157939763 159 NiSNNIFKAFGLNVFTDLKKFLQNRLLYEELI 190
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap