Conserved Protein Domain Family
PHA02836

?
PHA02836: PHA02836 
putative transmembrane protein; Provisional
Statistics
?
PSSM-Id: 165179
View PSSM: PHA02836
Aligned: 3 rows
Threshold Bit Score: 240.561
Threshold Setting Gi: 38229296
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38229296    1 MDLhEDDGTINDYSLFFVYDTADTIDSNDSLKEVLEDYFTWKAMVGRIGFVPSGIGNLFLKLIKLDDYFDKNSTKLLVNG 80 
157939761   1 MDL-QDNGIINDYSLFFAYDTANTISANDSLKNILDDYFTWRAMVGRIGFVPVGIGNLFLKLMNLNTYFDKDSINLLTSN 79 
12085120    1 MDL-QDNGIINDYSLFFAYDTANTISANDSLKNILDDYFTWRAMVGRIGFVPVGIGNLFLKLMNLNTYFDKDSINLLTSN 79 
38229296   81 LKRKRFINRLKKYLYSNYDISYLSFITLVGIFGYISERCGKYGKEKYIQNLLLLIFNFLNDNILFRFRYYLIKN 154
157939761  80 LSKKGFISRFKKYLYSNYDVSYVSALTLIGIIGYISECCGKLGLEKYIQDLLLLLFNFLDDNILFKLRYYLIKK 153
12085120   80 LSKKGFISRFKKYLYSNYDVSYVSALTLIGVIGYISECCGKIGLEKYIQDLLLLLFNFLDDNILFKLRYYLIKK 153
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap