Conserved Protein Domain Family
PHA02835

?
PHA02835: PHA02835 
putative secreted protein; Provisional
Statistics
?
PSSM-Id: 165178
View PSSM: PHA02835
Aligned: 2 rows
Threshold Bit Score: 259.207
Threshold Setting Gi: 157939754
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12085113    1 MILLIFLCVVITNLSPSYCNEYINSTILVNIKLGKKTCCNGFTYLLDNNLEFYNIMYSNVNVSINIENCYFNNSIFKNTK 80 
157939754   1 MILLIFLFIVITNLSSSYCNEYIDSTILVNIKLGKKTCYNGFTYLLDNNLEVYNIMYSNVNVSINIENCYFNNSIFKNTK 80 
12085113   81 HKNISILLTSKSNIQKNIAIIPITCKITIDITCTKNGKKKCLAQEKLPKTPNLIYKTAEHVNGIIDLNIYGSCVKYVYTR 160
157939754  81 HKNISILLTSKSNIQKNITIIPITCKITIDITCTKNGKKKCLVQKKLPKIPNLIYKTAEHVNGIIDLNIYGSCVKYIYTR 160
12085113  161 VNIYEISNGNLIYDQLDSNFLKLNTK 186
157939754 161 VNIYEISNGNLIYDQLDSNFLKLNTK 186
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap