Conserved Protein Domain Family
PHA02834

?
PHA02834: PHA02834 
chemokine receptor-like protein; Provisional
Statistics
?
PSSM-Id: 165177
View PSSM: PHA02834
Aligned: 3 rows
Threshold Bit Score: 445.118
Threshold Setting Gi: 38229303
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157939769   1 METTVLVDNYSYYFEE-ECDFEMVNS-DVNYFVIVFYILLFIFGLIGNVLVIAVLIVKRFMFVVDVYLFNIAMSDLMLVF 78 
12085128    1 METTVFVDNYSYYFEE-ECDFEMVNS-DVNYFVIVFYILLFIFGLIGNVLVIAVLIVKRFMFVVDVYLFNIAMSDLMLVF 78 
38229303    1 METATVVDNYSCYCSDrECDLKYTSGlRVNYFVMVLYTLLFIFGLVGNVLVITVLIIKRFIFTIDVYLFNIALSDMMLVF 80 
157939769  79 SFPFIIHNDLNEWIFGEFMCKLVLGVYFVGFFSNMFFVTLISIDRYILVVNATKIKNKSISLSVLLSVAAWVCSVLLSMP 158
12085128   79 SFPFIIHNDLNEWIFGEFMCKLVLGVYFVGFFSNMFFVTLISIDRYILVVNATKIKNKSISLSVLLSVAAWVCSVFLSMP 158
38229303   81 SFPFIIHNGLNEMIFGKIVCKLVSGTYFVGFFSNMFFIMLISIDRYISVVNATKIKSKSINLSILLSVSVWVCSIILSSP 160
157939769 159 AMVLYYVDNTDNLKQCI-FNDYHEKFSWSAFFNFEINIFGIVIPLIILIYCYSKILYTLKNCKNKNKTRSIKIILTVVVF 237
12085128  159 AMVLYYVDNTDNLKQCI-FNDYHENFSWSAFFNFEINIFGIVIPLIILIYCYSKILYTLKNCKNKNKTRSIKIILTVVLF 237
38229303  161 VMVLYHVDNMYYINHYImFNGKQKNFSLYTFLNFEINIFSTVI-LTISMYCYFKMLVTLKSCRNSIRTRPIKIILAVVTF 239
157939769 238 TVVLWVPFNIVLFINSLQSVGLIDIGCYHFKKIVYSIDIAELISFVHCCVNPIIYAFVGKNFKKVFKNMFCRTNNI---- 313
12085128  238 TVVFWVPFNIVLFINSLQSVGLIDIGCYHLKKIVYSIDIAELISFVHCCVNPIIYAFVGKNFKKVFKNMFCRTNNI---- 313
38229303  240 TTVFWIPFNAVLLVNSLYTVGLINISCYHFKKIVCSIHVLELISFFHCCVNPIIYSFVGKNFFRAFKTIFCKVNKIngvn 319
157939769 314 FIRQSSNNVI 323
12085128  314 FIRQSSNNVI 323
38229303  320 VSLRRSSTIF 329
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap