Conserved Protein Domain Family
PHA02831

?
PHA02831: PHA02831 
EEV host range protein; Provisional
Statistics
?
PSSM-Id: 165176
View PSSM: PHA02831
Aligned: 3 rows
Threshold Bit Score: 451.754
Threshold Setting Gi: 12085127
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157939768   1 MINLTKIIILSFI-SKTWCICVFNKNDAKYSNVDSYENKVYEENENLEYKCNNNFDKVFVTCNNGSWSTKNMCIGKTNCK 79 
38229302    2 NINMIKLIIILSVfSKTCAVCTFNKKDAEYSNVISYEDRTYKDNEKLNYECAYGFNSVFVICNNGSWSTKNMCIGKRNCK 81 
12085127    1 MINLTKIIILLFI-SKTWCICVFNKNDAKYSNVDSYENKVYEENENLEYKCNNNFDKVFVTCNNGSWSTKNMCIGKNNCK 79 
157939768  80 DPVTILNGYIKNKKDQYSFGDSVTYACKVNKLEKYSIVGNETVKCINKQWIPKYPVCKLIRCKYPALQNGFLN-VFEKKF 158
38229302   82 DPVMILNGNIKNKQDKYSLGDSVTYMCKVNKLERYSLVGNETVKCIDGKWVPDNPFCKLIRCKYPALQNGILEgSFKKKF 161
12085127   80 DPVTILNGYIKDKKDQYSFGDLVTYACKVNKLEKYSIVGNATVKCINKQWMPKYPVCKLIRCKYPALQNGFLN-VFEKKF 158
157939768 159 YYGDIVNFKCKKGFILLGSSVSTCDINSIWYPGIPKCVKDK-VNNVIQPNYLFDDLDEDFNNSTTNYNAQQniITIIILL 237
38229302  162 YYGDVVIFKCKTGFRLSGSLTSTCGINFVWVPNLPKCVKDSvVHDEVRSDYLFKYLNDSNNDYDTNYYMQN--IVAVIFL 239
12085127  159 YYGDIVNFKCKKGFILLGSSVSTCDINSIWYPGIPKCVKDK--FNNIQPNYLFDDLDEDFNNSTTNYNTQQniITIIILL 236
157939768 238 SIICFIFVLGLIalFLSCNKSTLKPSIYNKF 268
38229302  240 VIICFIFVLGLS--ILSCSFASTSKPSYDKL 268
12085127  237 SIICFIFVLGLIalFLSCNKSTLKPSIYNKF 267
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap