Conserved Protein Domain Family
PHA02828

?
PHA02828: PHA02828 
putative transmembrane protein; Provisional
Statistics
?
PSSM-Id: 165175
View PSSM: PHA02828
Aligned: 3 rows
Threshold Bit Score: 120.906
Threshold Setting Gi: 157939774
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38229308    3 MFSFIINIIYGSFYHITSSITKIFIYIISRLILFMLQMVNPYSSYSFISYLNPFKKqEEYFYFNPIRFINKMNPFYKEEE 82 
157939774   1 MFSFVINMIYNLFYYITSSVSKLFIFIVSKLILFMLQMVNPYSSYSIISYLNPFKK-EEYSFFNPLRLINKINPFYKEEK 79 
12085133    1 MFSFVINMIYNLFYYITSSVSKLFIFIVSKLILFMLQMVNPYSSYSIISYLNPFKK-EEYSFFNPLRLINKINPFYKEEK 79 
38229308   83 KStGIVNWLwRTKKTENKSwWKLF 106
157939774  80 KE-GILNWL-GMKKTETKS-WKLF 100
12085133   80 KE-GILNWL-GMKKTETKS-WKLF 100
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap