Conserved Protein Domain Family
PHA02827

?
PHA02827: PHA02827 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177492
View PSSM: PHA02827
Aligned: 15 rows
Threshold Bit Score: 242.029
Threshold Setting Gi: 62637381
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
211956276   5 HHIVNYAYCDEFTESDDITVAVADYLYWSSKEFRSRDRAGNVFVALESFKQEAIEVFGKDLTTFVKLLFLDSKEGFNHAK 84 
211956442   5 HHIVNYAYCDEFTESDDITVAVADYLYWSSKEFRSRDRAGNVFVALESFKQEAIEVFGKDLTTFVKLLFLDSKEGFNHAK 84 
62637381    5 YHIVNYAYCDEFTESDDITVAIADYLYWSSKEFRSRDRAGNVFVALESFKQEAIEVFGKDLTTFVKLLFLDSKEGFNHAK 84 
62637549    5 YHIVNYAYCDEFTESDDITVAIADYLYWSSKEFRSRDRAGNVFVALESFKQEAIEVFGKDLTTFVKLLFLDSKEGFNHAK 84 
18640236    1 -METNYIYRNDFLDNDDITTALLDYLYWSCLSYRHRDPAGKLFAVFESFKRDAEFVFGENIIGFVKYMFLDSIHGFAHSK 79 
15150595    1 MSSGNYVYRNNFSDDDDITTAISDYLFWSSLAFSSREVAGKVFLVFESFKKDASLVFGNDLTAFVKNMFLDSKIGFEQSK 80 
18640087    1 -METNYIYRNDFLDNDDITTALLDYLYWSCLSYRHRDPAGKLFAVFESFKRDAEFVFGENIIGFVKYMFLDSIHGFAHSK 79 
148912881   1 MSSGNYVYRNNFSDDDDITTAISDYLFWSSLAFSSREVAGNVFLVFESFKKDASLVFGNDLTAFVKNMFLDSKIGFEQSK 80 
9633969     1 --MAFYVRRNNFDAEDSVLLAVQDYLRWSSTPFRDREPAGCVFAVFESFKRDASIVFRDNVRWLVRCSY----KYVDSSE 74 
9633812     1 --MAFYVRRNNFDAEDSVLLAVQDYLRWSSTPFRDREPAGCVFAVFESFKRDASIVFRDNVRWLVRCSY----KYVDSSE 74 
211956276  85 SFITLSLERENLTQEACAIVGLLAKAAEYWGGEPIPTRASAKVLMLLGELLTFEDLTFVKATLINRMIKV 154
211956442  85 SFITLSLERENLTQEACAIVGLLAKAAEYWGGEPIPTRASAKVLMLLGELLTFEDLTFVKATLINRMIKV 154
62637381   85 SFIGLSLERENLTQEACAIVGLLAKAAEYWGGESIPTRASAKVLMLLGELLTFEDLTSVKAILINRMLKI 154
62637549   85 SFIGLSLERENLTQEACAIVGLLAKAAEYWGGESIPTRASAKVLMLLGELLTFEDLTSVKAILINRMLKI 154
18640236   80 SMISTMLKKENYIRESCAVVGLLARAASYWGGDERPTSASTKVLLLLKELLTDNELKFVKTAAIVRLKKY 149
15150595   81 IMINSMLKKENYIRESCAVIGILARAAEYWGGESSPTCSSVKVLVLLRDLVSDNDISLVKSALIIRLKRL 150
18640087   80 SMISTMLKKENYIRESCAVVGLLARAASYWGGDERPTSASTKVLLLLKELLTDNELKFVKTAAIVRLKKY 149
148912881  81 IMINSMLKKENYIRESCAVIGILARAAEYWGGESSPTCSSVKVLVLLRDLVSDNDISLVKSALIIRLKRL 150
9633969    75 SLIRAMLRHDNYITEACAVIGLLAQVAEYWGYDN-PIPISARVIELFMRLIADYEISHIRSVINIRLQCF 143
9633812    75 SLIRAMLRHDNYITEACAVIGLLAQVAEYWGYDN-PIPISARVIELFMRLIADYEISHIRSVINIRLQCF 143
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap