Conserved Protein Domain Family
PHA02826

?
PHA02826: PHA02826 
IL-1 receptor-like protein; Provisional
Statistics
?
PSSM-Id: 165173
View PSSM: PHA02826
Aligned: 5 rows
Threshold Bit Score: 302.604
Threshold Setting Gi: 21492461
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148912884   1 MKVINFIILICCFKSAFLSEYCKYRGGILTPVNVNFKDPAFLKCPLDNYKKSIFFKKN-ITSYNITWFQTNSLSFVRNYN 79 
15150445    1 MKVINFIILICCFKSAFLSEYCKYRGGILTPVNVNFKDPAFLKCPLDNYKKSIFFKKN-ITSYDITWFQTNSLSFVRNYN 79 
21492461    1 MKVINFIILICCFKSVFLSEYCKYRGGILTPVNVNFKDPAFLKCPLDNYKKSIFFKKN-ITSYDITWFQTNSLSFVRNYN 79 
62637394    1 -MILIIFFILLQFINC-LCLSCQYRGGDLIPSYAKDGDPMVLLCTGKHSKRSKFYDKTfITDYNVTWSKTDSLAFVRDSG 78 
211956289   1 MFLTILFYIFLQFISHFFCLNCRYRGGDTMPAYAKKGDPMVLLCTGKHMKKSDYKDKTfIDEYNVTWSKTDSLAFVRDSG 80 
148912884  80 DYKNFKKIeVNNENASRvqliGNNLWLYPVINIDDGIYICRFSSYNICEEMSIKLTFldKEETITYRFNEGFNSTVHCMD 159
15150445   80 DYKNFKKIeVNNENASRvqliGNNLWLYPVINIDDGIYICRFRSHNICEEMSIKLTFldKEETITYRFNEGLNSTVHCMD 159
21492461   80 DYKNFKKIeVTNENASRvqliGNNLWLYPVINIDDGIYICRFRSHDICEEMSIKLTFldKEETITYRFNEGLNSIVHCMD 159
62637394   79 ARTKIKTI-THNEIGDR----SENLWIGNSKKSNEGIYICTISNGNICEESTIRFSV--DSGLYNFQFHSGKDIKLACYG 151
211956289  81 ARTKITPI-THNEIGDR----SENLWIGNVDHKDEGVYICTISGGQRCEESTIRLTI--DSGTFNLQFQSGKDAKLTCYG 153
148912884 160 IDLISSYF-KNKTLDWYKNNNKVLYDDRIQ--NNKLKLVIKNTTHDDSGIYTCNLRINKDNINYDIKRNYNVVVL 231
15150445  160 IDLISSYF-KNKTLDWYKNNNKVLYDDRIQ--SNELKLVIKNTTHDDSGIYTCNLRINKDSINYDIKRNYNVVVL 231
21492461  160 IDLISSYF-KNNTLDWYKNNNKVLYDDRIQ--NNKLKLVIKNTTHDDSGIYTCNLRIKKDNINYDIKRNYNVVVL 231
62637394  152 TRGIQTTFkDDYTLTWSFNGIIIYGTEHIHlsNDNSTLTINSATNSDSGSYVCTLLFAYNSNNYNITKEYKVTII 226
211956289 154 TAGFRNTF-SDYTLTWFYNGDILPNTDRFQlrDGNSTLIIGSAGSEDSGLYLCALGFGFNSNNYNVTKEYKVTII 227
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap