Conserved Protein Domain Family
PHA02825

?
PHA02825: PHA02825 
LAP/PHD finger-like protein; Provisional
Statistics
?
PSSM-Id: 177491
View PSSM: PHA02825
Aligned: 6 rows
Threshold Bit Score: 195.4
Threshold Setting Gi: 148912888
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18450237   13 LDDVSLADKCCWICKEACDIVPNYCKCRGDNKIVHKECLEEWINTDvvKNKSCAICESPYNLKRRYKKITKWRCYKRDCH 92 
21492465    1 MEGSDNNNTHCWICKDEYNVSANFCNCKNEFKIVHKNCLEEWINFS--HDTKCKICNGKYNIKKNKKSCLRWKCSFMYCN 78 
18640095    1 ------MDPVCWICKDDYSIEKNYCNCKNEYKVVHDECMKKWIQYS--RERSCKLCNKEYNIISVRKPFSQWVFSIKDCK 72 
15150449    1 MEGSDNTNTHCWICKDEYNVSTNFCNCKNEFKIVHKNCLEEWINFS--HDTKCKICNGKYNIKKNKKSCLRWKCSFMYCN 78 
148912888   1 MEGSDNNNTHCWICKDEYNVITNFCNCKNEFKIVHKNCLEEWINFS--HDTKCKICNGKYNIKKNKKSCLRWKCSFIYCN 78 
9633956     7 MVDVSLVDKCCWICKESCDVVRNYCKCRGDNKIVHKECLEEWINTDtvKNKSCAICETPYNVKQQYKKLTKWRCYRRDCH 86 
18450237   93 DSLLVNMSLCLIVGGMgGYLLISTEIVKLIASEEVSNIAKVFLVSASMGPFMVSALTMVRACIDCRTYFIATRERNTIHE 172
21492465   79 VPAICVSLICLLLLPL-TILLVKFNLKSMLENIENRDLIALISVVAYSLPCVVGFITVIHILIALYDYYITAKSDNMTYQ 157
18640095   73 KSAILYATLFLCTFII-SLVLTRINITKIIDTSKNDVSFKLVTMVFYLLPFVITCISFITLIVYLYKYCKISAKNNTYDT 151
15150449   79 IPAICVSLICLLLLPL-TILLVKFNLKSMLENIENRDLITLISAIAYSLPCVVGFITVIHILIALYDYYLAAKSDNITYQ 157
148912888  79 VPAICVSLICLLLLTL-TILLVKFNLKSMLENIENSDLIALIYVIAYSLPCVVGFITVIHILIALYDYYLAAKSDNITYQ 157
9633956    87 DSLLVNLPLCLIVGGIsTYTLVSVEIIKLMESEETSELTKVFLVTSFLGPFIVTVLSALRTCIDCRTYFLTTRKRNTIHT 166
18450237  173 VAEME 177
21492465  158 VYEYI 162
18640095  152 IYEL- 155
15150449  158 VYEYI 162
148912888 158 VYEYI 162
9633956   167 LQELE 171
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap