Conserved Protein Domain Family
PHA02819

?
PHA02819: PHA02819 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165169
View PSSM: PHA02819
Aligned: 3 rows
Threshold Bit Score: 82.6784
Threshold Setting Gi: 15150483
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15150483   1 MDKLYSAIFGVFMSSSDDDFNNFINVVKSVLNdDENYNKKTKKSFLRYYLIIGLVTIVFVIIFIIFYLKVIK 72 
148912921  1 MDKLYSAIFGVFMSSSDDDFNNFINVVKSVLN-NENYNKKTKKSFLRYYLIIGLVMIVFVIIFIIFYLKVIK 71 
21492497   1 MDKLYSAIFGVFMSSSDDDFNNFINVVKSVLN-NENYNKKTKKSFLRNYLIIGLVTIVFVIIFIIFYLKVIK 71 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap