Conserved Protein Domain Family
PHA02818

?
PHA02818: PHA02818 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165168
View PSSM: PHA02818
Aligned: 3 rows
Threshold Bit Score: 105.435
Threshold Setting Gi: 21492514
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
21492514   1 MAEILTNKLKSIDNENKYNEKFIECIIQEIEKRQYFILKPIVRFIIDVMIIVIVLNDLTIRLLRRNYKILFSILLLSILY 80 
15150500   1 MAEILTNKLKSIDNENKYNEKLIECIIQEIEKQQYFILKPIVRFIIDVMIIVIVLNDLTIRLLKRNYKILFSIVLLSILY 80 
148912938  1 MAEILTNKLKSIDNENKYNEKFIECIIQEIEKQQYFILKPIVRFIIDVMIIVIVLNDLTIRLLKRNYKILFSILLLSILY 80 
21492514  81 DAFAHSNVSSDI 92 
15150500  81 DLFTHSDVSSDI 92 
148912938 81 DAFTHSDVSSDI 92 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap