Conserved Protein Domain Family
PHA02817

?
PHA02817: PHA02817 
EEV Host range protein; Provisional
Statistics
?
PSSM-Id: 165167
View PSSM: PHA02817
Aligned: 4 rows
Threshold Bit Score: 298.393
Threshold Setting Gi: 18640225
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
21492591    1 MKNIHMLLILLCNRVYSFCDyLNKCCYPPSIKNGYIYNKKTEYNIGSNVTFFCGNNTRGVRYTLVGEKNIICEKDGKWNK 80 
148913018   1 MKNIHMLLILLCNKVYSLCD-LNKCCYPPSIKNGYIYNKKTEYNIGSNVTFFCGNNTRGVRYTLVGEKNIICEKDGKWNK 79 
15150580    1 MKNIHMLLILLCNKVYSLCD-LNKCCYPPSIKNGYIYNEKTEYNIGSNVTFFCGNNTRGVSYTLVGEKNIICEKDGKWNK 79 
18640225    2 LLSLFILMYYMPNVIYCSCD------IPPDIVNGEIYDKKEVYSKGDSISYICGENKIGIPYSLIGNDVITCNKDGKWYP 75 
21492591   81 EFPVCKIIRCRFPALQNGFVNGIPDSKKFYYESEVSFSCKPGFVLIGTKYSVCGINSSWIPKVPICSRYNITYNKIYINK 160
148913018  80 KFPVCKIIRCRFPALQNGFVNGIPDSRKFYYESEVSFSCKPGFVLIGTKYSVCGINSSWIPKVPVCSRDNITYNKIYINK 159
15150580   80 EFPVCKIIRCRFPALQNGFVNGIPDSRKFYYESEVSFSCKPGFVLIGTKYSVCGINSSWIPKVPICSRDNITYNKIYINK 159
18640225   76 DPPRCEMIICRFPALQNGYVNGIPSNKKFYYKQKVSFTCKDGFLLAGEPYSICNINSTWFPDIPICIKNDKSLSIIIYNK 155
21492591  161 VSIDDNFFN----QINNSNTYYFDKILQI----NNVNKYTLIFFV-VVLIKILFGFAFIFFSCNKKPLDSIKYYK 226
148913018 160 VNIDDNFFN----QINNSNTYYFDKILQI----NNVNRYTLIFFV-VVSIKILFGFVFIFFSFNKKPLDSIKYYK 225
15150580  160 VNIDDNFFN----QINNSNTYYFDKILQI----NNVNRYTLIFFV-VVSIKILFGFVFIFFSCNKKPLDSIKYYK 225
18640225  156 N--DDDFKDldneDIVNANMRSINNTLEInitnNNISETTLLIILgSIGSIFIFGIILLIYSCSNSVNN--KYSK 226
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap